PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00076481001
Common NameGSBRNA2T00076481001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 235aa    MW: 26916.3 Da    PI: 7.4497
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00076481001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.66.7e-342377155
              G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                         kprlrWt eLHerFv+av++LGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  GSBRNA2T00076481001 23 KPRLRWTAELHERFVDAVTHLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 77
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.2E-322078IPR009057Homeodomain-like
PROSITE profilePS5129412.532080IPR017930Myb domain
SuperFamilySSF466894.48E-172278IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-242378IPR006447Myb domain, plants
PfamPF002495.7E-82575IPR001005SANT/Myb domain
PfamPF143793.4E-12123162IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MMQSREERRS ESPSGLVLTT DPKPRLRWTA ELHERFVDAV THLGGPDKAT PKTIMRVMGV  60
KGLTLYHLKS HLQKFRLGKQ PHKDHSHGHS TNIRDPNRVS MLDLQRNVVF TTPHITGHNM  120
NEMQTEVHRR IEEEVELERQ VNQRIEAQGK YMESMLEKAC ETQEASLTKD YSTLFFDRTT  180
ICNNSSPLTI QWFEDQFPSS SSMDSAMHLP DINSNFSLQD SRSSITKNHT VCLG*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00351DAPTransfer from AT3G12730Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00076481001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009124669.11e-177PREDICTED: myb family transcription factor APL-like
SwissprotQ9SAK51e-69APL_ARATH; Myb family transcription factor APL
TrEMBLA0A078I2Q11e-177A0A078I2Q1_BRANA; BnaA01g30340D protein
TrEMBLM4FE191e-177M4FE19_BRARP; Uncharacterized protein
STRINGBra039340.1-P1e-177(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM137451726
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12730.11e-142G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]